Loading...
HomeMy WebLinkAboutItem A: EWEB Master Plan ECC UGENE ITY OUNCIL AIS GENDA TEM UMMARY Work Session: Eugene Water & Electric Board Riverfront Master Plan Meeting Date: June 12, 2013 Agenda Item Number: A Department: Planning and Development Staff Contact: Gabe Flock www.eugene-or.gov Contact Telephone Number: 541-682-5697 ISSUE STATEMENT This work session will provide another opportunity for the council to learn more about Eugene Water & Electric Board’s (EWEB) Riverfront Master Plan proposal, in advance of the upcoming public hearing. As a reminder, this is a quasi-judicial process which requires that the work session be limited to factual information and questions about the request. The council should avoid prematurely expressing opinions or deliberating on the merits of the proposal in advance of the public hearing, which is scheduled for June 17, 2013. BACKGROUND At the council’s last work session on this topic, staff provided an overview of the proposal, including the regulatory actions proposed for implementation of the EWEB Riverfront Master Plan. As a reminder, the formal land use applications proposed by EWEB to implement the master plan, are briefly summarized below: Metro Plan Amendment (MA 12-1): amends the Metro Plan diagram to reflect the master plan vision for mixed-use redevelopment; changes land use designation from primarily heavy industrial to mixed use. Refinement Plan Adoption & Related Amendments (RA 12-1): adopts the EWEB Downtown Riverfront Specific Area Plan; also amends the Downtown Plan and Riverfront Park Study to remove obsolete sections and ensure consistency. Code Amendments (CA 12-4): amends the Eugene Code to establish a new (S-DR) Downtown Riverfront Special Area Zone including form-based standards for future redevelopment; also includes related code amendments to integrate the new zoning with existing code sections. Zone Change (Z 12-6): rezones the site from public land and industrial zoning to the new (S-DR) Downtown Riverfront Special Area Zone. Willamette Greenway Permit (WG 12-4): approves a Willamette Greenway Permit for future development that is consistent with the new plan and zone. S:\CMO\2013 Council Agendas\M130612\S130612A.doc Staff also responded to a number of questions and comments about the proposal at the work session. Additional responses and relevant materials are organized by topic and addressed below. Public Access to, and within the EWEB Riverfront Site The council asked how this master plan would promote access to the site both as a destination, and for casual use. The master plan and related code provisions ensure a new public street system that reconnects the site to downtown from 5 and 8 avenues. This will provide the critical thth connection linking downtown to the river. The plan envisions this primary riverfront street as a “Great Loop” that provides pedestrian- friendly, bicycle, vehicular and transit access to the site from downtown. The concept also includes the ability to close sections of this riverfront street for festivals or other public events, but otherwise provide a convenient, pleasant streetscape environment for a wide variety of potential users, whether as residents, retail customers, or park users. The proposed bike path and boardwalk, adjacent to “Restaurant Row” and the new riverfront park, can accommodate a variety of users including bike commuters and more casual recreational users. Transit service was closely considered in the master planning process with the involvement of a focus group that included Lane Transit District staff, City transportation staff and a variety of community members with interest in transportation issues. As a result, the primary street has been designed to ensure that it will accommodate future transit service, but with the realization that the specific type and location of service will depend on future build-out and a variety of details that naturally come later in the redevelopment process. Attachment A includes an excerpt from the master plan that shows the site’s relationship to regional, community and local transit service including rail, EmX, and the Breeze. It shows existing routes and how bus service could be routed to the site in the future. The vision for the EWEB property is to expand the range of opportunities for commercial and residential development throughout the entire downtown and to create the desired mix of uses and high quality development within a compact urban core as called for in Envision Eugene. The proposal is intended to help realize the potential for this site to be a special destination downtown, where residents, visitors, downtown employees, and students come for activities that strengthen downtown, reinforce the identity of the community and its ties to the area’s most significant natural resource, the Willamette River. Willamette Greenway and Water Resource Protections There are two primary types of land use regulation that apply to natural resource/water resource protection on the EWEB Riverfront site:  Willamette River Greenway (Goal 15)--The majority of the EWEB site is within the Willamette River Greenway Boundary. As such, a Willamette River Greenway permit is included in the adoption package. This permit and the proposed code include a new Willamette River Greenway setback to ensure protection of the expanded open space, riparian area and scenic values along the river.  Water Resource Overlay Zoning (Goal 5)--While the typical setback for the Willamette River is 100 feet from the top-of-bank, the EWEB site is almost entirely developed up to the current bike path with either paving or buildings. As such, future development in the “prior developed areas” is exempt from these setback and use restrictions. EWEB, S:\CMO\2013 Council Agendas\M130612\S130612A.doc however, is proposing extensive development setbacks, almost two acres more, than are required by current code. The Planning Commission reviewed this issue in detail during their deliberations and ultimately found that the proposal resulted in an overall expansion of the protected and enhanced area along the river. Attachment B illustrates the proposed Willamette River Greenway setback, and the extent of areas that are otherwise exempt from the Water Resource overlay setbacks (currently paved or existing buildings). Potential Funding Sources for Public Improvements Implementing the master plan will require on-going collaboration and leveraging of funds from multiple sources. There are a variety of public and private funding sources that will likely be considered. Private sources primarily include developer investment, potentially from multiple developers. Public sources could include grants from state or federal sources, Riverfront urban renewal funds and other City-controlled sources, as well as participation from EWEB. As an example, Public Works staff is coordinating with EWEB to pursue federal grant funding to reconstruct and realign the section of riverfront path within the master plan area. Additional options such as the formation of a local improvement district and other public-private partnerships have also been discussed. Until a development entity and a timeline are secured, amounts and sources are difficult to estimate. Options and future decisions regarding financial tools, incentives, and public-private partnerships will come back to the council for further discussion once the regulatory framework is in place. Future Park Site/ Riverfront Open Space The same is true of options that exist for future park ownership and maintenance, which will depend largely on the outcome of this process to first establish the park location and basic regulatory framework for redevelopment of the site. In the case of the EWEB property, an existing Memorandum of Understanding (MOU) identifies the City’s option to declare interest in all or a part of the site, once the proposed land use application package is adopted and EWEB indicates its intent to sell the property. A variety of options exist and have yet to be decided in terms of future ownership and management of the park site. Based on the level of interest in the proposed riverfront open space, additional details are provided in Attachment C, including a set of design guidelines and a detailed open space diagram from the plan. These materials help to show the intended location for various park improvements, riparian enhancements, native habitat areas, interpretive sites and other park elements including areas that could be available for community gardens. The proposal is based upon a “Riverfront Ecological Analysis and Design” report that was prepared during the master planning process, which includes an analysis and recommendations about the site’s ecological condition, riparian restoration, and balancing of these opportunities among economic, social, and environmental concerns. A specific native planting list developed as part of this analysis is included in the adoption package. These materials help to show the balanced approach envisioned in the master plan for compact urban development, reconnecting downtown S:\CMO\2013 Council Agendas\M130612\S130612A.doc to the river, and maximizing natural resource values in context with a variety of policy goals for the site. (For access to this document, please refer to the materials at: http://www.eugene- or.gov/index.aspx?NID=2358 beginning on page 630 of the record.) Sustainability Principles (Triple Bottom Line) A fundamental element of the master planning process from the beginning was to establish a vision statement and guiding principles that address the “triple bottom line” of sustainability (see Attachment D). This vision and the guiding principles were approved by the Community Advisory Team to help inform the process based on an understanding of the inter-dependence of the community’s social, economic, and environmental concerns. This framework also recognizes the unique opportunity to advance these interests and model sustainability principles in a tangible way for the entire community, through redevelopment of the EWEB riverfront site. As such, the proposed adoption package is intended as a reflection of that inter-dependence and balance, with numerous examples throughout the materials that implement sustainability principles. New Mixed-Use Redevelopment Potential The adoption package includes a variety of regulatory actions that, as intended, would create a substantial amount of new capacity for a mix of residential, office, commercial and employment uses on the site as compared to its current industrial designation and largely vacant character. This additional capacity can help to meet the needs identified in Envision Eugene for both multi- family housing and commercial jobs. Additional information was requested at the last work session about more specific estimates of that new capacity. Based on the applicant’s analysis of market feasibility and various redevelopment scenarios under the proposed zoning, estimated build-out would create:  250-400 new dwelling units,  22,000-28,000 square feet of new retail space,  14,000 square feet of restaurant use, and  40,000-315,000 square feet of additional office uses. Form-Based and Traditional Zoning (“Hybrid”) Code Provisions Additional information about the difference between form-based elements and traditional zoning provisions was also requested at the last work session. The proposed special area zone includes some of both, and is therefore considered a “hybrid” form-based code by integrating form-based elements with existing, traditional code provisions. Staff believes that one of the advantages of the form-based approach is its focus on standards that try to articulate what the City wants to see built, rather than traditional codes which tend to focus on preventing what the City doesn’t want. A key means for accomplishing this is the focus on urban design standards. These standards are perhaps the most obvious form-based elements of the proposed zoning that are intended to ensure an active streetscape, appropriately scaled buildings, and pedestrian-friendly character. Maximum building envelopes, minimum building heights, step-backs for taller buildings, articulation and window transparency requirements, and main entrance orientation are examples of the form-based standards that have been tailored to the site in order to achieve the intended result. One key difference as compared to traditional zoning is the inclusion of user-friendly graphics to represent the standards and better reflect what is allowed and what is not in terms of building S:\CMO\2013 Council Agendas\M130612\S130612A.doc form and the public streetscape. Another key difference is that the allowed uses are organized in broad categories to encourage a more generous mixing of uses (e.g. retail on the ground floor, with offices and residential units above); in general, form-based codes are much less predicated on the separation of uses as compared to traditional zoning. In this case, careful consideration was still given to prohibit certain uses such as heavy industrial or suburban-style residential housing, and to require minimum residential density above the ground floor along key street frontages. Public Testimony Overview from Planning Commission Hearing At the Planning Commission’s initial public hearing held on February 5, 2013, following a presentation from EWEB’s staff and consultant team, testimony was received from 18 individuals in support of the request. There were two individuals who had questions or otherwise indicated a neutral position, and two individuals with testimony in opposition to the request. Several themes emerged in that testimony including appreciation for extensive public input opportunities in the master planning process, the balanced and careful consideration of various stakeholder interests, the vision for compact but sensitive and well-designed mixed-use redevelopment, and based upon the proposal for a new riverfront park with ample public access, river-oriented amenities, and enhancement of the riparian area along the river’s edge. Opposing testimony mainly expressed concern about the perceived shortcomings of the plan’s ecological analysis and protections along the river’s edge. RELATED CITY POLICIES The Eugene Code and Downtown Plan require the City’s approval of a master plan for redevelopment of the EWEB riverfront property. The adopted policy reads as follows: A master plan for the EWEB riverfront property must be approved by the City before any redevelopment, land use application, rezoning, Metro Plan or refinement plan diagram amendments are approved for uses not associated with EWEB functions. The master plan shall be evaluated based on the master plan’s consistency with principles (1) through (4) below: (1) Create a “people place” that is active, vibrant, accessible and multi-use. (2) Provide appropriate setbacks, deeper where environmental or habitat issues are more critical, shallower in other areas. (3) Incorporate appropriate building and site design techniques that address environmental concerns. (4) Incorporate an educational aspect, so that the riverfront improvements teach the community about its river, history and city. EWEB’s proposed land use application package is intended to fulfill this policy and to implement the regulations needed to ensure that redevelopment of the site remains consistent with the conceptual master plan. Findings addressing the applicable approval criteria, including Statewide Planning Goals and other adopted City policies for this request, are included in the applicant’s written statement for the land use application package. S:\CMO\2013 Council Agendas\M130612\S130612A.doc COUNCIL OPTIONS This is an informational work session; no action is necessary at this time. CITY MANAGER’S RECOMMENDATION As noted above, this is an informational work session; no action is necessary at this time. SUGGESTED MOTION None. ATTACHMENTS A.Transit Service Study Materials B.Willamette Greenway and Water Resource Setbacks C.Open Space Diagram and Design Guidelines D.Master Plan Guiding Principles FOR MORE INFORMATION Staff Contact: Gabe Flock Telephone: 541-682-5697 Staff E-Mail: gabriel.flock@ci.eugene.or.us S:\CMO\2013 Council Agendas\M130612\S130612A.doc %-7%XXEGLQIRX% );)&6MZIVJVSRX1EWXIV4PER 2nd 3rd 4th Amtrak ALTON BAKER PARK Station 5th 6th 7th WILLAMETTE RIVER 8th 9th 10th Downtown Transit Station Em X 11th 12th University of Oregon 13th 6IKMSREP 'SQQYRMX]8VERWMX )Q<&YW6ETMH8VERWMXPMRI 0SGEP&VII^IPMRI 1SWXSJXLI);)&TVSTIVX]MW[MXLMREQMRYXI[EPOMRKHMWXERGI )\MWXMRKERH4VSTSWIH 7XVIIXW [LMGLMWEGERHMHEXIJSVXLIMQTVSZIH'EWGEHMELMKLWTIIHVEMPWIVZMGI 9466%QXVEO7XST 8LITVSTIVX]MWEPWS[MXLMRVIEGLSJ0ERI8VERWMX(MWXVMGXvW)Q<&YW %HHMXMSREP4YFPMG8VERWMX 'SRRIGXMSRW 6ETMH8VERWMXWIVZMGIEW[IPPEWXLI&VII^IPMRIWIVZMRKXLI9RMZIVWMX] (S[RXS[RERHEVIEWRSVXLSJXLIVMZIV  6S[IPP&VSOE[%VGLMXIGXW`4;04EVXRIVWLMT`;687SPSQSR)8'`'SKMXS );)&6MZIVJVSRX1EWXIV4PER 3rd Ave 4th Ave 5th Ave 6th Ave 7th Ave 8th Ave Broadway 6IGSQQIRHIH&YW7IVZMGI )\MWXMRK&YW6SYXI[MXL7XST 0SGEP8VERWMX 4VSTSWIHu+VIEX0SSTv8VERWMX 7IVZMGIXS(S[RXS[RERH6MZIV 8LMWHMEKVEQWLS[WLS[I\MWXMRKFYW 'SRRIGXXS)\MWXMRK7IVZMGI WIVZMGIQMKLXFIVIVSYXIHXSWIVZIXLIWMXI'YVVIRXP]XLI&VII^IXYVRW HS[R4IEVP7XVIIXJVSQXL%ZIRYIFIJSVIXYVRMRKEPSRKXL%ZIRYIXSXLI ZMEHYGX-X[SYPHFITSWWMFPIXSWIVZIXLIWMXIF]PSSTMRKXLIFYWEPSRKXL ERHXL%ZIRYIW8LI&VII^ISJJIVWZEPYEFPIGSRRIGXMSRW[MXL(S[RXS[R ERHXLI9RMZIVWMX]ERHXSXLI'SFYVK6SEHGSVVMHSV 8LIGVIEXMSRSJERI[TYFPMG 'VIEXIEw+VIEX0SSTx[MXL4YFPMG8VERWMX XVERWMXWIVZMGIXLEXGSRRIGXW(S[RXS[R[MXLXLIVMZIVJVSRX[EWTSTYPEV HYVMRKGSRZIVWEXMSRW[MXLXLIGSQQYRMX]ERH[SYPHTVSZMHIEHHMXMSREP EGGIWWERHZMWMFMPMX]XSXLIVMZIVJVSRXWMXI  6S[IPP&VSOE[%VGLMXIGXW`4;04EVXRIVWLMT`;687SPSQSR)8'`'SKMXS %-7%XXEGLQIRX& );)&6MZIVJVSRX1EWXIV4PER /I]'SRXI\X;MPPEQIXXI+VIIR[E] %VIEWEFSZIXSTSJFEROXLEX[IVIHIZIPSTIH 8[SI\MWXMRKVIKYPEXMSRWTVSXIGXXLI;MPPEQIXXI TVMSVXS2SZIQFIVEVII\IQTXJVSQXLI 6MZIVJVSQMRGSQTEXMFPIVIHIZIPSTQIRXSR ;6GSRWIVZEXMSRWIXFEGOWXERHEVHFYXHIWTMXI XLI);)&WMXIXLII\MWXMRKTVSTIVX]MRGPYHIW XLITVSTIVX]vWI\IQTXMSRXLIHIWMKRTVSTSWEP E;EXIV6IWSYVGIW ;6 ^SRMRKSZIVPE]SR LSRSVWXLIMRXIRXSJXLI;6VIKYPEXMSR&IPS[ EVIEWIEWXSJXLI*IVV]7XVIIX:MEHYGXERH XSTSJFEROER]TPERRIHVMTEVMERIRLERGIQIRX VIHIZIPSTQIRXTVSTSWEPWSRXLIWMXI[MPPEPWS [MPPRIIHXSGSQTP][MXLXLI;6^SRI RIIHXSVIGIMZIE;MPPEQIXXI+VIIR[E]TIVQMX +MZIRI\MWXMRKGSRHMXMSRWETTPMGEFPIGVMXIVME 8LIKSEPSJXLI;MPPEQIXXI+VIIR[E]MWwXS ERHXLIPSGEXMSRSJTVSTSWIHGSRWXVYGXMSRXLI TVSXIGXGSRWIVZIVIWXSVIIRLERGIERH QEWXIVTPERI\TIGXWXSFIMRGSQTPMERGI[MXL QEMRXEMRXLIIGSPSKMGEPREXYVEPWGIRMG XLI+VIIR[E]ERH;6SZIVPE]VIKYPEXMSRW LMWXSVMGEPEKVMGYPXYVEPIGSRSQMGGYPXYVEPERH 8LIHIWMKRTVSTSWIWXLEXEPPRI[FYMPHMRKWEVI VIGVIEXMSREPUYEPMXMIWERHVIWSYVGIWEPSRKXLI QSVIXLERvJVSQXSTSJFERO7IZIVEPEGVIW ;MPPEQIXXI6MZIVx-XMWETIVQMXXMRKTVSGIWW SJZIKIXEXIHTYFPMGSTIRWTEGI[MPPFIGVIEXIH EPSRKXLIVMZIVJVSRX8LMWREXYVEPM^IHPERHWGETI MWI\XIRHIHMRXSXLIWMXIETTVS\MQEXIP]vEX SVHIZIPSTQIRX[MXLMRXLIFSYRHEVMIWSJXLI 1MPPTSRH7[EPIERHvEXXLI7)IRHSJXLI +VIIR[E] )' -REGGSVHERGI[MXLXLI WMXI%XXLI1MPPTSRH7[EPISTIRWTEGII\XIRHW +VIIR[E]vWGVMXIVMEEvHMWXERGILEWFIIR XLIJYPPHITXLSJXLITVSTIVX] EHSTXIHEWXLIEHIUYEXIWIXFEGOEPSRKXLMW VIEGLSJXLI;MPPEQIXXI6MZIV 8LI(S[RXS[R4PERvWJSYV6MZIVJVSRX'VMXIVME MRGPYHIXLII\TIGXEXMSRXLEXXLIVMZIVJVSRX 6IHIZIPSTQIRX[MPPRIIHXSQIIXXLIETTPMGEFPI QEWXIVTPER[MPPwTVSZMHIETTVSTVMEXIWIXFEGOW VIKYPEXMSRWSJXLI;EXIV6IWSYVGIW ;6  HIITIV[LIVIIRZMVSRQIRXEPSVLEFMXEXMWWYIW SZIVPE]%;6SZIVPE]KIRIVEPP]EHHVIWWIW EVIQSVIGVMXMGEPWLEPPS[IVMRSXLIVEVIEWx 8LIXIVQwETTVSTVMEXIxMWPERKYEKIXLEXVIPEXIW [EXIVVIWSYVGILEFMXEXERHMWGSRWMHIVIH XSXLIWXERHEVHWETTPMIHF]XLI;6SZIVPE] QSVIWXVMRKIRXXLERXLI;MPPEQIXXI+VIIR[E] [LMGLXLIHIWMKRLSRSVWERHI\GIIHW8LI ;6VIKYPEXMSRWMQTPIQIRXXLI7XEXI[MHI+SEP TVSTSWEPvWwYRHYPEXMRKKVIIRIHKIxEPWS ;EXIV6IWSYVGIW'SRWIVZEXMSR4PER )' EPPS[WJSVXLIGVIEXMSRSJRI[LEFMXEXERH  -RXLIGEWISJXLI);)&TVSTIVX] IGSPSKMGEPZEPYI[LIVIPMXXPIXSRSRIGYVVIRXP] XLI;6SZIVPE]MWXVMKKIVIHFIGEYWIXLI I\MWXW-RXLMWWIRWIXLIHIWMKRTVSTSWEPJEV TVSTIVX]MWEHNEGIRXXSXLI;MPPEQIXXI6MZIVE I\GIIHWVIKYPEXSV]VIUYMVIQIRXWXLEXWXVYGXYVI 'EXIKSV]%[EXIVVIWSYVGIXLEXLEWEWXERHEVH XLIVIPEXMSRWLMTFIX[IIRHIZIPSTQIRXERH GSRWIVZEXMSRWIXFEGOSJvJVSQXSTSJFERO [EXIV[E]W ,S[IZIVXLII\MWXMRK);)&TVSTIVX]MWEPWSE TVIZMSYWP]HIZIPSTIHWMXIERHETTVS\MQEXIP]  MQTIVZMSYWWYVJEGIMRMXWGYVVIRXWXEXI  6S[IPP&VSOE[%VGLMXIGXW`4;04EVXRIVWLMT`;687SPSQSR)8'`'SKMXS );)&6MZIVJVSRX1EWXIV4PER WLS[WXLII\MWXMRK XSTSJFEROERHEvWIXFEGOHMWXERGISRXLI);)& VMZIVJVSRXTVSTIVX]8LIREVVS[VIHLEXGLTEXXIVR FIX[IIRXSTSJFEROERHXLI]IPPS[TVSTIVX]PMRI MRHMGEXIXLIEVIE[LIVIIRLERGIQIRXWRIIHWXS GSQTP][MXLXLI;EXIV6IWSYVGIW ;6 SZIVPE]8LI [MHIVVIHLEXGLTEXXIVRQEVOWXLIEVIE[MXLMRXLI vWIXFEGOHMWXERGIXLEXEVITVIZMSYWP]HIZIPSTIH ERHI\IQTX8LIQEWXIVTPERTVSTSWIWXLEXEPPRI[ FYMPHMRKWSVEHHMXMSRWXSI\MWXMRKWXVYGXYVIWEVIQSVI XLERvJVSQXSTSJFERO  6S[IPP&VSOE[%VGLMXIGXW`4;04EVXRIVWLMT`;687SPSQSR)8'`'SKMXS 500 East 4th Avenue Eugene, OR 97401 EUGENE WATER & ELECTRIC BOARD X %-7%XXEGLQIRX' );)&6MZIVJVSRX1EWXIV4PER  6MTEVMER)RLERGIQIRX-RXIVTVIXMZI7MXIW  z2EXYVIXVEMPEXXSTSJFERO z7IEXMRKEVIEWEPSRKREXYVIXVEMP z)HYGEXMSREPEWTIGXWMRXIVTVIXMZIWMXIWVIPEXIHXSVMZIV REXYVEPW]WXIQWGYPXYVEPLMWXSV]TYFPMGEVXIXG  XL%ZIRYI4PE^E z4YFPMGKEXLIVMRKTPEGIIZIRXPSGEXMSR  z/MRIXMG[EXIVJIEXYVI z*IWXMZEPWXVIIXXLEXGERFIGPSWIHXSXVEJJMG  -RJSVQEP7IEXMRK8IVVEGI  z-RJSVQEPWXSRIWIEXMRKSRFPSGOWMRXIV[SZIR[MXL REXMZIZIKIXEXMSR z3ZIVPSSOWVMZIVJVSRXSTIRWTEGI  );)&;EXIV4PE^E z)\MWXMRK4PE^EERHVMZIVSZIVPSSO   8VEMR;LMWXPI4PE^E  4VMZEXI3TIR7TEGI     6MZIVFERO8VEMP7]WXIQ    ;EXIV-RXEOI-RXIVTVIXMZI7MXI   4YFPMG%GGIWWXS6MZIVFERO8VEMP7]WXIQ  34)274%')   463+6%1    4SPPMREXSV/RSPP 3ZIVPSSO z2EXMZIQIEHS[YTPERHTVEMVMI  z8IVQMRYWSJXL%ZIRYIZMI[GSVVMHSV z4YFPMGP]EGGIWWMFPISZIVPSSO[MXLVMZIVZMI[W  z:MI[MRKWLIPXIVEXXSTSJORSPP  z4MGRMGKVSZIFIVV]TMGOMRKTEXGLEXFEWISJORSPP  9VFER%KVMGYPXYVI  z'SQQYRMX]KEVHIRW z'SQQYRMX]SVGLEVHW  z4SXXMRKWLIHWERHKEVHIRWXSVEKI  6MZIV3ZIVPSSO  z8IVQMRYWSJXL%ZIRYI+VIEX7XVIIX  z&IEYXMJYPZMI[WEGVSWWERHYTVMZIVMRXIVTVIXMZIWMXI z4SXIRXMEPFMOITIHFVMHKIXS%PXSR&EOIV4EVO   +VIIR)\XIRWMSRW;IXPERH3TIR7TEGI4IHIWXVMER3VMIRXIH+VIIR7XVIIXW z2EXYVEPW]WXIQWEX[SVOz6EMRKEVHIRWERHFMSW[EPIW z7XSVQ[EXIVGPIERWMRK[IXPERHWz7XVIIXXVIIWERHREXMZITPERXMRKW  z2EXMZITPERXWz%GXMZIJVSRXEKIW[MXLwI]IWSRXLIWXVIIXx z;EPOMRKTEXLWWIEXMRKERHZMI[MRKHIGOWz7TIGMEPTEZMRKEXJIEXYVIEVIEW  z4SXIRXMEPGSRRIGXMSRXS1MPPVEGIEX1MPPTSRH7[EPI   6MZIVJVSRX4EVO  %HZIRXYVI4PE]%VIE z2EXMZIQIEHS[XLEXGERFIQS[RJSVJIWXMZEPW  z'LMPHVIRvWTPE]EVIEERHSZIVPSSOXS[IXPERHz2EXMZITPERXWERHXVIIW z;EXIVTPE]XSHVEMRMRXS[IXPERHz-RJSVQEPWIEXMRK TEXLW z2EXYVEPTPE]WXVYGXYVIWz7XSVQ[EXIVGPIERWMRKERHGSPPIGXMSR    6MZIV&SEVH[EPO6MZIV3ZIVPSSMO  z4YFPMGTVSQIREHISZIVPSSOMRKVMZIVz)HYGEXMSREPEWTIGXMRXIVTVIXMZIWMXI z7IEXMRKXIVVEGIWz:EVMIX]SJWIEXMRKSTTSVXYRMXMIW z%(%GSRRIGXMSRWXSGSRXMRYSYWFMOITEXL z6EMRWLIPXIV XVEMPEPSRKXSTSJFEROz4VSZMHIWZMI[WYTERHHS[RVMZIVERHSZIVPSSOW z'SRRIGXMSRXS6IWXEYVERX6S[TEXMSWERHXIVVEGIW IRLERGIHVMTEVMER^SRI  6S[IPP&VSOE[%VGLMXIGXW`4;04EVXRIVWLMT`;687SPSQSR)8'`'SKMXS *-+96)()7-+2+9-()0-2)7'90896%00%2(7'%4) 34)274%') ()7-+2+9-()0-2)7 '90896%00%2(7'%4) 34)274%') )YKIRIvWHS[RXS[RVMZIVJVSRXMWETPEGIXLEX[IWLEVIQEOMRK FIYWIHXSHMVIGXXLIHIWMKRERHGSRWXVYGXMSRSJ'YPXYVEP MXERMHIEPPERHWGETIJSVGSQQYRMX]IHYGEXMSRERHPIWWSRWJVSQ 0ERHWGETIERH3TIR7TEGIEVIEWGSRGITXYEPP]WLS[RMRXLI LMWXSV]8LISZIVEVGLMRKSTIRWTEGITVSTSWEPMWJSVE'YPXYVEP (S[RXS[R6MZIVJVSRX7TIGMEP%VIE>SRI 7(6 ERHMR*MKYVIW 0ERHWGETIEPSRKXLIVMZIV{EGSQQYRMX]XVSZISJKVIIRWTEGI ERH*SVXLITYVTSWIWSJXLIWIKYMHIPMRIWXLI MRXIVTVIXMZIWMXIWTYFPMGEVXZMWXEWERHLMWXSVMGWXVYGXYVIWXLEX TLVEWIwXSXLII\XIRXTVEGXMGEFPIxQIERWXLEXXLIKYMHIPMRIEW XIEGLEFSYXXLILMWXSV]ERHGYPXYVIIQFIHHIHEPSRKXLI HIWGVMFIH[MPPFIQIXXSXLII\XIRXTSWWMFPI[LMPIEPWSEPPS[MRK VMZIVJVSRXWMXI8LIMRXIRXMWXSYWIXLIVMZIVJVSRXPERHWGETIXS XLIHIWMKRXSQIIXWEJIX]VIUYMVIQIRXWIRWYVIGSQTEXMFMPMX] XIEGLERHMRWTMVIMRUYMV]MRXSSYVGSQQYRMX]vWLMWXSV]MRE FIX[IIREHNEGIRXTEVOERHSTIRWTEGIJIEXYVIWQIIXWXEXI ZEVMIX]SJ[E]WERHEXEZEVMIX]SJWGEPIW ERHJIHIVEPVIKYPEXSV]VIUYMVIQIRXWMRGPYHMRK%(%EGGIWWMFMPMX] VIUYMVIQIRXWWXE][MXLMRXLIGSRWXVYGXMSRERHQEMRXIRERGI FYHKIXSJXLIPERHQEREKMRKEKIRG]ERHIRWYVIXLEXXLI F]XLI6MZIVJVSRX)GSPSKMGEP%REP]WMWERH(IWMKR6ITSVXEW JEGMPMXMIWGERFIWYWXEMREFP]QEMRXEMRIHSZIVXLIMVPMJIXMQI8LMW [IPPEWI\XIRWMZIMRTYXJVSQXLITYFPMGQIIXMRKWRYQIVSYW [MPPVIUYMVIMRWSQIGEWIWXLEXXLIKYMHIPMRIWFIPS[[MPPFIQIX WXEOILSPHIVMRXIVZMI[WVIPIZERXTVIGIHIRXWXLVSYKLSYXXLI XSEPIWWIVHIKVIIMRSVHIVXSQIIXSXLIVVIUYMVIQIRXWMRGPYHMRK XLSWIPMWXIHEFSZI XIEQ8LVSYKLXLMW[SVOERHEHHMXMSREPVIWIEVGLIRZMVSRQIRXEP (IWMKRWJSVHIZIPSTQIRXSJER]PERHXLEX[MPPFIS[RIHSV TVMQEV]IGSPSKMGEPSFNIGXMZIWSJXLISTIRWTEGIHIWMKR QEREKIHF]XLI'MX]WLEPPFIVIZMI[IHERHETTVSZIHF]XLI )YKIRI4EVOWERH3TIR7TEGIHMZMWMSRTVMSVXSETTPMGEXMSRJSV 8LI%TTIRHM\MRGPYHIWETVIPMQMREV]PMWXSJVIGSQQIRHIH PERHYWIETTVSZEPWERHFYMPHMRKTIVQMXW MRXIVTVIXMZIWMXIXSTMGWJSVXLI'YPXYVEP0ERHWGETI8LIHIWMKR KYMHIPMRIWSRXLITEKIWXLEXJSPPS[HMVIGXXLIHIWMKRERH GSRWXVYGXMSRSJ'YPXYVEP0ERHWGETIERH3TIR7TEGIEVIEW 50 Rowell Brokaw Architects '90896%00%2(7'%4) 34)274%') ()7-+2+9-()0-2)7 +VIIRMRJVEWXVYGXYVIQE]MRGSVTSVEXI[EPOMRKTEXLW 4%6/786%-07%6)%7 EGGIWWMFPIWIEXMRKERHZMI[MRKFSEVH[EPOW 6MZIVJVSRX4EVO8SXLII\XIRXTVEGXMGEFPI 8LIVMZIVJVSRXTEVOWYVJEGIWLEPPFIKVEHIHXSWPSTI 49&0-'40%>%7 HS[R[EVHJVSQXLIVIPSGEXIH6MZIVFERO8VEMPXS[EVHWXLI XL%ZIRYI4PE^E8SXLII\XIRXTVEGXMGEFPI ;MPPEQIXXI6MZIV[LMPIVIXEMRMRKVIUYMVIHGSZIVEKISZIV 8LITPE^EWLEPPFIHIWMKRIHXSJYRGXMSREWETYFPMGKEXLIVMRK I\MWXMRKFYVMIHMRJVEWXVYGXYVI WTEGIERHSVIZIRXPSGEXMSR 8LIVMZIVJVSRXTEVOWLEPPMRGPYHIQYPXMTPIGPYWXIVWSJXVIIW 8LITPE^EWLEPPMRGPYHIEWYVJEGIKVEHIOMRIXMG[EXIVJIEXYVI 8VIIWQE]RSXFITPERXIH[MXLMRZMI[GSVVMHSVWWLS[RMR MRXIVTVIXMZIHMWTPE]SVEVXJIEXYVI *MKYVI 8LITPE^EQYWXFIGSRWXVYGXIHSJELEVHWYVJEGIQEXIVMEP 8LIVMZIVJVSRXTEVOWLEPPMRGPYHIEGGIWWMFPITEXL %WTLEPXWYVJEGMRKMWTVSLMFMXIH GSRRIGXMSRWJVSQXLIVIPSGEXIH6MZIVFERO8VEMPXSXLI REXYVIXVEMPPSGEXIHRIEVXLIXSTSJFERO 3:)6033/7-28)646)8-:)7-8)7 8LIVMZIVJVSRXTEVOWLEPPMRGPYHISRISVQSVIMRJSVQEP -RXIVTVIXMZI7MXIWERH3ZIVPSSOW8SXLII\XIRXTVEGXMGEFPI WIEXMRKEVIEW 8[SSZIVPSSOWWLEPPFITVSZMHIHMRPSGEXMSRWGSRGITXYEPP] 8LIVMZIVJVSRXTEVOWLEPPMRGPYHIMRXIVTVIXMZIJEGMPMXMIWXLEX WLS[RMR*MKYVI6MZIVSZIVPSSOWWLEPPFIHIWMKRIHXS JIEXYVIIHYGEXMSREPMRJSVQEXMSRVIPEXIHXSXLIVMZIVREXYVEP TVSZMHIZMI[WYTVMZIVERHHS[RVMZIV W]WXIQWGYPXYVEPLMWXSV]TYFPMGEVXSVWMQMPEVGSRXIRX -RXIVTVIXMZIWMXIWWLEPPMRGPYHIIHYGEXMSREPHMWTPE]WERH QEXIVMEPWVIPEXIHXSXLIVMZIVREXYVEPW]WXIQWGYPXYVEPLMWXSV] 4SPPMREXSV4EVO8SXLII\XIRXTVEGXMGEFPI TYFPMGEVXSVWMQMPEVGSRXIRXERHWIEXMRK 4PERXMRKW[MXLMRXLITSPPMREXSVTEVOWLEPPFIGSQTVMWIHSJ 7YKKIWXIHMRXIVTVIXMZIJEGMPMX]PSGEXMSRWMRGPYHI TSPPIRERHRIGXEVJSVEHYPXMRWIGXTSPPMREXSVWEW[IPPEW %XXLIIEWXIRHSJXLIKVIIRMRJVEWXVYGXYVIW]WXIQRSVXL PEVZEPLSWXTPERXWXLEXTVSZMHIJSSHJSVGEXIVTMPPEVW8LI SJXLI+VIEX7XVIIX*IWXMZEP7XVIIX RYQFIVERHZEVMIX]SJWTIGMIWXLIMVVIPEXMZIEFYRHERGI ERHXLIMVWTEXMEPSVKERM^EXMSRWLEPPFIHIZIPSTIHMR MRXIVWIGXMSRSJXL%ZIRYIERH1MPP7XVIIX GSRNYRGXMSR[MXLPSGEPREXMZITPERXERHTSPPMREXSVI\TIVXW 2IEVXLITVSTSWIHVIGVIEXMSREPPERHWGETIEVIEERH KVIIRMRJVEWXVYGXYVIW]WXIQW 2IEVXLII\MWXMRK[EXIVMRXEOIWXVYGXYVI 6MZIVFERO8VEMP8SXLII\XIRXTVEGXMGEFPI 8LI6MZIVFERO8VEMPWLEPPFIVIPSGEXIHERHGSRWXVYGXIHEW %HHMXMSREPSTXMSREPKYMHIPMRIWJSVXLIGSRWXVYGXMSRERHPSGEXMSRSJ GSRGITXYEPP]WLS[RMR*MKYVI VMZIVSZIVPSSOWERHMRXIVTVIXMZIWMXIWEVIMRGPYHIHMR%TTIRHM\& 8LI6MZIVFERO8VEMPWLEPPEFYXXLITVSTSWIHTIHIWXVMER FSEVH[EPOFYXEXEPS[IVIPIZEXMSRXLERXLIFSEVH[EPO +VEHIWJSVFSXLXVEMPWWLEPPFIEHNYWXIHXSTVSZMHI ,%&-8%8>32)72%8-:)40%28'31192-8-)71%2%+)1)28 JYRGXMSREPWITEVEXMSRETTVSTVMEXIXSXLIWMXI 1EREKIQIRX+YMHIPMRIW %HZIRXYVI0ERHWGETI%VIE8SXLII\XIRXTVEGXMGEFPI STIRWTEGIEVIEWQEREKIQIRXTPERWJSVTYFPMGTEVOERH 8LIEHZIRXYVIPERHWGETIEVIEWLEPPMRGPYHIREXYVEP KVIIRMRJVEWXVYGXYVIEVIEWQYWXFIETTVSZIHF]XLI'MX]SJ IPIQIRXWVIPEXIHXSXLIVMZIVPERHWGETISVKVIIR )YKIRI4EVOWERH3TIR7TEGI(MZMWMSRERHMQTPIQIRXIHEW MRJVEWXVYGXYVIWYGLEWVSGOWFSYPHIVWPSKWSVVIGSZIVIH MRHYWXVMEPEVXMJEGXW 7XERHEVHWJSVXLIIZEPYEXMSRSJQEREKIQIRXTPERWWLEPPFI 8LIEHZIRXYVIPERHWGETIEVIEWLEPPFIPSGEXIHEHNEGIRXXS KVIIRMRJVEWXVYGXYVI 8LIEHZIRXYVIPERHWGETIEVIEWLEPPFIHIWMKRIHXSFI FIWXQEREKIQIRXTVEGXMGIWXEOMRKMRXSEGGSYRXXLIMQTEGXW GSQTEXMFPI[MXLEHNEGIRXYWIW SJTPERRIHLYQERYWIWSJXLIWIEVIEW1EREKIQIRXTPERW WLEPPMRGPYHIWYKKIWXIHTIVJSVQERGIXEVKIXWJSVXLIGSRXVSP +6))2-2*6%7869'896) SJMRZEWMZITPERXWTIGMIWERHJSVREXMZIWTIGMIWHMZIVWMX]ERH +VIIR-RJVEWXVYGXYVI +VIIRMRJVEWXVYGXYVIQE]MRGPYHIFYXMWRSXPMQMXIHXS TVEGXMGIWGSRWMWXIRX[MXLQEMRXEMRMRKMQTSVXERXLEFMXEX ZIKIXEXIHWXSVQ[EXIVJEGMPMXMIWXLEXEVIHIWMKRIHXSXVIEX IPIQIRXWERHWXVYGXYVI WXSVQ[EXIVJVSQEHNEGIRXWXVIIXWERHHIZIPSTQIRX 51 Rowell Brokaw Architects EWEB Riverfront Master Plan Guiding Principles Before the design phase began, the Community Advisory Team worked to describe a set of shared values that elaborated on the four Riverfront Criteria in the Downtown Plan. The intent was to give further clarity and direction to the design team, and to account for the full context of the project. These shared values are expressed in seven Guiding Principles that the CAT approved by consensus in September 2009. The specific representation of these principles was developed during the course of the public design process, but the underlying values were strong and consistent throughout the project. Sustainable Urbanism The redevelopment of the EWEB riverfront site transforms a vacated utility yard into a pedestrian- oriented, balanced, green community Urban design principles that promote livability, walkability, connections to open space, and the integration of urban and natural systems provide the basis for this plan's framework. By laying the groundwork for a people - oriented, multi -use redevelopment that meets LEED standards, this master plan has the potential to model sustainable urbanism, reduce our reliance on fossil fuels, and demonstrate Eugene's commitment to being a sustainable city. Balance of Uses This plan includes a diverse mix of public and private spaces, with a variety of uses and opportunities layered within each. The opportunity to generate vitality and variety is the result of "rich edges' where the public and private realms overlap. The plan also accommodates numerous redevelopment and use scenarios. Multiple scales of redevelopment and building types are accommodated by the framework; this creates the opportunity for diversity in building AIS Attachment D types, target markets and architectural character. Through the overlapping of public open space and private uses like cafes and restaurants, public amenities offer cultural, educational, recreational, artistic and community benefits. Connection The master plan reconnects the city with the river, and extends the riverine landscape into the city. It improves bike and pedestrian access to the riverfront path system and creates a dramatic sequence of open spaces. The design provides terraced, separated paths that safely accommodate multiple modes of transportation. A public riverfront is maintained, and view corridors are created or enhanced. The proposal makes the downtown riverfront accessible to all ages and abilities, and gives preference to the pedestrian and bicyclist while providing adequate vehicular access as well. Ecology The master plan's ecological objectives should focus on education and habitat enhancement. New riverfront open space, river -edge connectivity, and a variety of open space types are proposed by the design. Green streets and an integrated stormwater system slow and cleanse runoff before it enters the Willamette, and native plant communities are planned throughout the 27 -acre site. Urban agriculture and habitat roofs are incorporated to add diversity to the site's urban ecology. A 70 -page ecological assessment of the design was completed (see Appendix), and offers key recommendations that are consistent with the design proposal. The assessment also includes specific recommendations for plant species, habitat design and maintenance to be carried forward by this plan. 44 ■ Rowell Brokaw Architects I PWL Partnership I WRT / Solomon E.T.C. I Cogito EWEB Riverfront Master Plan * Identity The riverfront master plan proposes a 9 -acre Cultural Landscape that teaches about the many layers of history, ecology, art and industry imbedded in this site. Multiple interpretive sites with specific stories to tell are identified by the plan. The property is recognized as our shared, downtown riverfront and includes design guidelines to create a pedestrian- oriented, lively public realm. Above all, the riverfront plan directs the development of a place that is accessible and welcoming to all. Economics The master plan proposal was tested for its ability to contribute to the economic vitality of Eugene. Sale of riverfront property will generate a financial return for EWEB to benefit ratepayers, and redevelopment will contribute to the tax base and riverfront urban renewal district. Infrastructure enhancements also contribute community value in a variety of ways. Feasibility Feasibility is often tied to existing conditions, standard practices, political climate, and community support for a project. Multiple use scenarios were tested to access the flexibility of the design framework, and to ensure that the proposal would not preclude positive adaptations and unforeseen opportunities. A preliminary development program and implementation options research were completed as part of the project's development. Extensive public outreach ensured that the design developed in a way that was consistent with community desires and values, and that input to the design was identifiable and accurately reflected. Rowell Brokaw Architects I PWL Partnership I WRTI Solomon E.T.C. I Cogito ■ 45 Rowell Brokaw DRAFT Axehitects September 9, 2009 0 EWEB RIVERFRONT MASTER PLAN GUIDING PRINCIPLES The following is a draft, working document that has been reviewed by the Community Advisory Team (CAT). It is expected that this document will continue to evolve with additional input from the CAT, EWER Board of Commissioners and public. DRAFT VISION STATEMENT: This Master Plan is based upon the understanding that our community's social, ecological,, economic and sustainable Concerns are interdependent The redevelopment of the EWEB riverfront property offers the unique oppodunity to advance these interests simultaneously for the benef;t of all Eugene, and to revisior) our downtown riverfront as a place that participates actively and graciously with the community that surrounds it DOWNTOWN PLAN RIVERFRONT PRINCIPLES: 1. Create a "pecple place" that is active, vibrant, accessible and multi-use. 2. Provide appropriate setbacks, deeper where environmental or habitat issues are more critical, shallower in other areas. 3, Incorporate appropriate building and site design techniques that address environmental concerns. 4. Incorporate an educational aspect, SD that our rivwfront improvernents teach us about our river, our history and our city. SUSTAINABLE URBANISM ■ Demonstrates Eugene's commitment to sustainability Applies urbar design principles to promote a pedestrian-oriented, livable downtown ■ Integrates urban, ecological and architectural considerations Incorporates "green" building and design principles ■ Increases density near the heart of the city ■ Provides shared infrastructure that advances the potential for sustainable development (e.g., renewable energy, landscaped stormwater treatment, water conservation, waste mitigation. accommodation of urban agriculture) • Creates a place that is socially and economically diverse BALANCE OF USES ■ Includes a diverse mix of public and private spaces ■ Balances and - integrates the natural and built environments ■ Incorporates a diversity of housing options that bring vitality to the site ■ Contributes to a resurgence of Downtown living opportunities Rowell Bta kaw Arch Kett s, R. C. 0 ri e Easi. 8 roadwq, Su i te 3 DO fugene, 0opcion 97401 Voice(541)US- 1.4413 Fax (541) 4BS-7344 WWW.F■WLWhr0kAW.r9M Rowell Brokaw DRAFT7 September 9, 2009 ■ Develops public amenities that Offer CUItUFal, educational, recreational. artistic and social benefits ECOLOGY ■ Protects and enhances complex river ecology ■ Aligns riparian restoration with river and site hydrology ■ Enhances the wrrimunity's ecologlc;al awareness ■ Protects habitat for aquatic and terrestrial species on and near the site ■ Recogri7es this property as part of the Willamette River watershed IDENTITY ■ Captures Eugene's unique identity ■ Recognl,79s this place as Fugane's Downtown Riverfront ■ Redevelops a rrulti-use, active, livable community ■ Honors Eugene's industrial history and EWEB's history of providing and conserving energy and water • Integrates the layers of Eugene's history imbedded in the site ■ Seeks a distinctive, beautiful aesthetic ■ Creates a welcoming place for all CONNECTION ■ Connects the river to the city and the city to the river ■ Maintains a public river edge and continuous riverbank trail ■ Seeks collaboration and compatibility molth neighbors • Creates view corridors to the river ■ Improves access to and from the site for all modes of transportation • Is pedestrian- and bicycle-criented Is accessible and safe for everyone ECONOMICS • Is economically viable, vibrant and resilient ■ Generates a financial return to EWEB to benefit ratepayers ■ Contributes to economic vitality through taxes and employment Contributes to community value through infrastructure enhancements IFF-ASIBILITY ■ Generates political and community support for the redevelopment of the downtown riverfront Is flexible to allow for adaptation and unforeseen opportunities ■ Cultivates Iocal capacities and expertise ■ Delivers tangible, immediate benefits for long-term investments Contributes to the vitality of Eugene ■ Creates a master plan framework that is economically feasible